PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36322.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 347aa    MW: 39232.9 Da    PI: 6.5035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36322.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.3e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
       KHN36322.1 14 KGPWSPEEDAKLKSYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding36.98.2e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       KHN36322.1  69 GGFSEEEDNIICSLYVSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.467962IPR017930Myb domain
SuperFamilySSF466891.25E-2611109IPR009057Homeodomain-like
SMARTSM007175.4E-131364IPR001005SANT/Myb domain
PfamPF002496.2E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-251569IPR009057Homeodomain-like
CDDcd001675.05E-101662No hitNo description
PROSITE profilePS5129421.33763117IPR017930Myb domain
SMARTSM007177.5E-1167115IPR001005SANT/Myb domain
PfamPF002491.6E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2370117IPR009057Homeodomain-like
CDDcd001671.01E-771111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKSYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYVSIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
QRKEQQAQAQ ARRVSNNQQK QDLKRETENL VVASEVINQV PYWSSSEFSS VPMPVVNASF  180
QHYGLNNQTS LGSMIVNKLE GITFSNDHHQ QQQQPYANAC EIPSLQDQAF PTMVNQVTVV  240
SNENNSGTYQ PSNIFQGFEN FPSDFCEPVC VNPQQMEAFN YGMESMDMTM SNGGSTNTTS  300
TESTSWGDMS SLVYSPLVSD YERCRQGIPQ DHVVAFEECK YFEMQMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0974030.0BT097403.1 Soybean clone JCVI-FLGm-16K1 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003516624.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y92e-87RAX3_ARATH; Transcription factor RAX3
TrEMBLA0A0B2RX080.0A0A0B2RX08_GLYSO; Transcription factor RAX3
STRINGGLYMA01G40411.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-77myb domain protein 84
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]